Skip to main content

Solulink

solulinkAt Solulink, we develop high-performance products that link biomolecules together. Our continuous efforts in new product development and service offerings enable you to remain at the forefront of advanced bioscience research. The Company’s proprietary HyNic/4FB chemistry is unique among bioconjugation methods in combining superb stability with high specificity and versatility, suitable for conjugation of all classes of biomolecules, including peptides, proteins, oligonucleotides, and carbohydrates, with all types of labels, including fluorophores, chromogenic moieties, surfaces, and small molecules. HyNic/4FB chemistry underlies the majority of Solulink’s extensive product catalog, comprised of various kits and tools that enable efficient and stable antibody, bead, and oligonucleotide labeling.

www.solulink.com

The prices are on request! Contact Us by e-mail info@sobekbio.com

Leading Biology

LeadingBiology

With experienced biologists, Leading Biology continuously optimizes the process and the quality assurance in manufacturing, dedicated to exploring and designing products on a higher level. The specialty in antibody engineering and synthetic biology make it possible to develop effective, convenient and simplified products with excellent performance in research. In national and international collaborations, their team of biologists has applied their experience and research results to the development of biological products to meet our customers’ different needs.

Leading Biology offers more than 30,000 self-developed antibodies & proteins, hundreds of ELISA kits, and proteins.

www.leadingbiology.com

The prices are on request! Contact Us by e-mail info@sobekbio.com

Yeastern Biotech

yeasternbiotech

Mission
Yeastern Biotech Co., Ltd. (YB) was founded in 2000 with the goal of providing intelligent technical services and high-quality products for life sciences research and the biomedical industry. Yeastern Biotech believes that a scientist’s greatest help comes from fellow scientists. Therefore, our innovative interdisciplinary research team with highly qualified experts in different fields offers ODM and OEM research-only reagents and kits as well as diagnostic products.

Aim & Prospect
The spirits of innovation, integration, and humanism in biotechnology are Yeastern Biotech’s executive prospects. Based on their possession of excellent research capabilities and professional technical platforms, they head for long-term targets at developing their own brand of life science and biomedical products.

www.yeastern.com

The prices are on request! Contact Us by e-mail info@sobekbio.com

CDK5R1 Rabbit pAb (APR21052N) APR21052N



The add to cart button will appear once you select the values above

Specifications

50µl / 100µl / 200µl

Product info:

The protein encoded by this gene (p35) is a neuron-specific activator of cyclin-dependent kinase 5 (CDK5); the activation of CDK5 is required for proper development of the central nervous system. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form. The cleavage of p35 into p25 results in relocalization of the protein from the cell periphery to nuclear and perinuclear regions. P25 deregulates CDK5 activity by prolonging its activation and changing its cellular location. The p25 form accumulates in the brain neurons of patients with Alzheimer's disease. This accumulation correlates with an increase in CDK5 kinase activity, and may lead to aberrantly phosphorylated forms of the microtubule-associated protein tau, which contributes to Alzheimer's disease.

Alternative names:

CDK5R1; CDK5P35; CDK5R; NCK5A; p23; p25; p35; p35nck5a

Species reactivity:

Human, Mouse, Rat

Host:

Rabbit

Cellular localisation:

Cell membrane, Cytoplasm, Cytoplasmic side, Lipid-anchor, Nucleus, perinuclear region

Isotype:

IgG

Immunogen:

Recombinant fusion protein containing a sequence corresponding to amino acids 99-307 of human CDK5R1 (NP_003876.1).

Positive control:

Mouse brain, Rat brain

AA Sequence:

AQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR

Purification:

Affinity purification

Molecular weight:

Calculated MW: 34kDa Observed MW: 24-35kDa

Form:

Liquid

Applications:

Request info at info@sobekbio.com

Dilution:

WB 1:500 - 1:2000 IF 1:50 - 1:200

Storage buffer:

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Storage:

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

More info:

Email: info@sobekbio.com

Orders:

Email: orders@sobekbio.com