Skip to main content

Solulink

solulinkAt Solulink, we develop high-performance products that link biomolecules together. Our continuous efforts in new product development and service offerings enable you to remain at the forefront of advanced bioscience research. The Company’s proprietary HyNic/4FB chemistry is unique among bioconjugation methods in combining superb stability with high specificity and versatility, suitable for conjugation of all classes of biomolecules, including peptides, proteins, oligonucleotides, and carbohydrates, with all types of labels, including fluorophores, chromogenic moieties, surfaces, and small molecules. HyNic/4FB chemistry underlies the majority of Solulink’s extensive product catalog, comprised of various kits and tools that enable efficient and stable antibody, bead, and oligonucleotide labeling.

www.solulink.com

The prices are on request! Contact Us by e-mail info@sobekbio.com

Leading Biology

LeadingBiology

With experienced biologists, Leading Biology continuously optimizes the process and the quality assurance in manufacturing, dedicated to exploring and designing products on a higher level. The specialty in antibody engineering and synthetic biology make it possible to develop effective, convenient and simplified products with excellent performance in research. In national and international collaborations, their team of biologists has applied their experience and research results to the development of biological products to meet our customers’ different needs.

Leading Biology offers more than 30,000 self-developed antibodies & proteins, hundreds of ELISA kits, and proteins.

www.leadingbiology.com

The prices are on request! Contact Us by e-mail info@sobekbio.com

Yeastern Biotech

yeasternbiotech

Mission
Yeastern Biotech Co., Ltd. (YB) was founded in 2000 with the goal of providing intelligent technical services and high-quality products for life sciences research and the biomedical industry. Yeastern Biotech believes that a scientist’s greatest help comes from fellow scientists. Therefore, our innovative interdisciplinary research team with highly qualified experts in different fields offers ODM and OEM research-only reagents and kits as well as diagnostic products.

Aim & Prospect
The spirits of innovation, integration, and humanism in biotechnology are Yeastern Biotech’s executive prospects. Based on their possession of excellent research capabilities and professional technical platforms, they head for long-term targets at developing their own brand of life science and biomedical products.

www.yeastern.com

The prices are on request! Contact Us by e-mail info@sobekbio.com

CFL1 Rabbit pAb (APR23493N) APR23493N



The add to cart button will appear once you select the values above

Specifications

50µl / 100µl / 200µl

Product info:

The protein encoded by this gene can polymerize and depolymerize F-actin and G-actin in a pH-dependent manner. Increased phosphorylation of this protein by LIM kinase aids in Rho-induced reorganization of the actin cytoskeleton. Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.[supplied by OMIM, Apr 2004]

Alternative names:

CFL1; CFL; HEL-S-15; cofilin; cofilin-1

Species reactivity:

Human, Mouse, Rat

Host:

Rabbit

Cellular localisation:

Cell projection, Cytoplasm, Cytoplasmic side, Nucleus matrix, Peripheral membrane protein, cytoskeleton, lamellipodium membrane, ruffle membrane

Isotype:

IgG

Immunogen:

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CFL1 (NP_005498.1).

Positive control:

HeLa, A-549, Jurkat, 293T, Mouse brain, Mouse liver, Mouse kidney, Rat brain, Rat ovary

AA Sequence:

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLV

Purification:

Affinity purification

Molecular weight:

Calculated MW: 18kDa Observed MW: 19KDa

Form:

Liquid

Applications:

Request info at info@sobekbio.com

Dilution:

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Storage buffer:

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Storage:

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

More info:

Email: info@sobekbio.com

Orders:

Email: orders@sobekbio.com