KCNK1 Rabbit pAb (APR19446N) APR19446N
Specifications
| 50µl / 100µl / 200µl |
Product info:
This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.
Alternative names:
KCNK1; DPK; HOHO; K2P1; K2p1.1; KCNO1; TWIK-1; TWIK1
Species reactivity:
Human, Mouse, Rat
Host:
Rabbit
Cellular localisation:
Apical cell membrane, Cell junction, Cell membrane, Cell projection, Cytoplasmic vesicle, Multi-pass membrane protein, Perikaryon, Recycling endosome, dendrite, synapse
Isotype:
IgG
Immunogen:
Recombinant fusion protein containing a sequence corresponding to amino acids 267-336 of human KCNK1 (NP_002236.1).
Positive control:
U-87MG, A-549, Mouse liver
AA Sequence:
FCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH
Purification:
Affinity purification
Molecular weight:
Calculated MW: 38kDa Observed MW: 38kDa
Form:
Liquid
Applications:
Request info at info@sobekbio.com
Dilution:
WB 1:500 - 1:2000 IHC 1:50 - 1:200
Storage buffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Storage:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
More info:
Email: info@sobekbio.com
Orders:
Email: orders@sobekbio.com
Fine Biotech is an ISO9001:2008 Certified Company,offers a full line of quality research kits,which include ELISA Kits,related ELISA assistant reagents and more high quality antibodies, recombinant proteins. Fine Biotech technical support are delicated to providing with professional and friendly assistance for our customers. Strict and multiple quality control ensure that our products continue to successfully supply for the international market. Moreover, we strive to continuously improve the customer experience through comprehensive technical support. High quality,rapid turnaround and personal support for all FineTest services are guaranteed. Should you have any problems,or any ideas on ways that we can improve our service,please feel free to call upon us.Thank you for your interest in FineTest products and we look forward to supplying you in the near future.