KTN1 Rabbit pAb (APR19086N) APR19086N
Specifications
| 50µl / 100µl / 200µl |
Product info:
This gene encodes an integral membrane protein that is a member of the kinectin protein family. The encoded protein is primarily localized to the endoplasmic reticulum membrane. This protein binds kinesin and may be involved in intracellular organelle motility. This protein also binds translation elongation factor-delta and may be involved in the assembly of the elongation factor-1 complex. Alternate splicing results in multiple transcript variants of this gene.
Alternative names:
KTN1; CG1; KNT; MU-RMS-40.19; kinectin
Species reactivity:
Human, Mouse, Rat
Host:
Rabbit
Cellular localisation:
Endoplasmic reticulum membrane, Single-pass type II membrane protein
Isotype:
IgG
Immunogen:
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KTN1 (NP_001072989.1).
Positive control:
K-562, SKOV3, Raji, HeLa, HT-1080, Mouse heart, Rat testis
AA Sequence:
MEFYESAYFIVLIPSIVITVIFLFFWLFMKETLYDEVLAKQKREQKLIPTKTDKKKAEKKKNKKKEIQNGNLHESDSESVPRDFKLSDALAVEDDQVAPV
Purification:
Affinity purification
Molecular weight:
Calculated MW: 149kDa/150kDa/152kDa/156kDa Observed MW: 178kDa
Form:
Liquid
Applications:
Request info at info@sobekbio.com
Dilution:
WB 1:500 - 1:2000 IHC 1:50 - 1:200
Storage buffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Storage:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
More info:
Email: info@sobekbio.com
Orders:
Email: orders@sobekbio.com
Fine Biotech is an ISO9001:2008 Certified Company,offers a full line of quality research kits,which include ELISA Kits,related ELISA assistant reagents and more high quality antibodies, recombinant proteins. Fine Biotech technical support are delicated to providing with professional and friendly assistance for our customers. Strict and multiple quality control ensure that our products continue to successfully supply for the international market. Moreover, we strive to continuously improve the customer experience through comprehensive technical support. High quality,rapid turnaround and personal support for all FineTest services are guaranteed. Should you have any problems,or any ideas on ways that we can improve our service,please feel free to call upon us.Thank you for your interest in FineTest products and we look forward to supplying you in the near future.