PCNA Rabbit pAb (APR17379N) APR17379N
Specifications
| 50µl / 100µl / 200µl |
Product info:
The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome.
Alternative names:
PCNA; ATLD2
Species reactivity:
Human, Mouse, Rat
Host:
Rabbit
Cellular localisation:
Nucleus
Isotype:
IgG
Immunogen:
Recombinant fusion protein containing a sequence corresponding to amino acids 1-261 of human PCNA (NP_002583.1).
Positive control:
HeLa, MCF7, 293T, COS-7, Mouse spleen, Rat testis
AA Sequence:
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Purification:
Affinity purification
Molecular weight:
Calculated MW: 28kDa Observed MW: 34KDa
Form:
Liquid
Applications:
WB (Homo sapiens, Mus musculus, Rattus norvegicus, Capra hircus) IF (Homo sapiens, Mus musculus, Rattus norvegicus) IHC (Mus musculus, Homo sapiens, Rattus norvegicus)
Dilution:
WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200
Storage buffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Storage:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
More info:
Email: info@sobekbio.com
Orders:
Email: orders@sobekbio.com
Fine Biotech is an ISO9001:2008 Certified Company,offers a full line of quality research kits,which include ELISA Kits,related ELISA assistant reagents and more high quality antibodies, recombinant proteins. Fine Biotech technical support are delicated to providing with professional and friendly assistance for our customers. Strict and multiple quality control ensure that our products continue to successfully supply for the international market. Moreover, we strive to continuously improve the customer experience through comprehensive technical support. High quality,rapid turnaround and personal support for all FineTest services are guaranteed. Should you have any problems,or any ideas on ways that we can improve our service,please feel free to call upon us.Thank you for your interest in FineTest products and we look forward to supplying you in the near future.