CPT1A Rabbit pAb (APR25713N) APR25713N
Specifications
| 50µl / 100µl / 200µl |
Product info:
The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Alternative names:
CPT1A; CPT1; CPT1-L; L-CPT1
Species reactivity:
Human, Mouse, Rat
Host:
Rabbit
Cellular localisation:
Mitochondrion outer membrane, Multi-pass membrane protein
Isotype:
IgG
Immunogen:
Recombinant fusion protein containing a sequence corresponding to amino acids 497-756 of human CPT1A (NP_001027017.1).
Positive control:
MCF7, Mouse kidney, Mouse heart, Rat heart
AA Sequence:
GYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPETGIISQGPSSDT
Purification:
Affinity purification
Molecular weight:
Calculated MW: 86kDa/88kDa Observed MW: 88KDa
Form:
Liquid
Applications:
IHC (Human lung cancer cells, Homo sapiens, Mus musculus) WB (Human lung cancer cells, Human bone marrow cancer cell, Homo sapiens, Sus scrofa, Mus musculus, Rattus norvegicus, Gallus gallus)
Dilution:
WB 1:500 - 1:2000 IF 1:50 - 1:200 IP 1:50 - 1:100
Storage buffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Storage:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
More info:
Email: info@sobekbio.com
Orders:
Email: orders@sobekbio.com
Fine Biotech is an ISO9001:2008 Certified Company,offers a full line of quality research kits,which include ELISA Kits,related ELISA assistant reagents and more high quality antibodies, recombinant proteins. Fine Biotech technical support are delicated to providing with professional and friendly assistance for our customers. Strict and multiple quality control ensure that our products continue to successfully supply for the international market. Moreover, we strive to continuously improve the customer experience through comprehensive technical support. High quality,rapid turnaround and personal support for all FineTest services are guaranteed. Should you have any problems,or any ideas on ways that we can improve our service,please feel free to call upon us.Thank you for your interest in FineTest products and we look forward to supplying you in the near future.