Skip to main content

Fine Biotech

finetest logoFine Biotech is an ISO9001:2008 Certified Company,offers a full line of quality research kits,which include ELISA Kits,related ELISA assistant reagents and more high quality antibodies, recombinant proteins. Fine Biotech technical support are delicated to providing with professional and friendly assistance for our customers. Strict and multiple quality control ensure that our products continue to successfully supply for the international market. Moreover, we strive to continuously improve the customer experience through comprehensive technical support. High quality,rapid turnaround and personal support for all FineTest services are guaranteed. Should you have any problems,or any ideas on ways that we can improve our service,please feel free to call upon us.Thank you for your interest in FineTest products and we look forward to supplying you in the near future.

www.fn-test.com

The prices are on request! Contact Us by e-mail info@sobekbio.com

CD68 Rabbit pAb (APR26631N) APR26631N



The add to cart button will appear once you select the values above

Specifications

50µl / 100µl / 200µl

Product info:

This gene encodes a 110-kD transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. The protein primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. It is a type I integral membrane protein with a heavily glycosylated extracellular domain and binds to tissue- and organ-specific lectins or selectins. The protein is also a member of the scavenger receptor family. Scavenger receptors typically function to clear cellular debris, promote phagocytosis, and mediate the recruitment and activation of macrophages. Alternative splicing results in multiple transcripts encoding different isoforms.

Alternative names:

CD68; GP110; LAMP4; SCARD1

Species reactivity:

Human, Mouse, Rat

Host:

Rabbit

Cellular localisation:

Cell membrane, Endosome membrane, Lysosome membrane, Single-pass type I membrane protein, Single-pass type I membrane protein

Isotype:

IgG

Immunogen:

Recombinant fusion protein containing a sequence corresponding to amino acids 22-319 of human CD68 (NP_001242.2).

Positive control:

THP-1, U-937, RAW264.7, Mouse liver, Rat liver, Rat lung

AA Sequence:

NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRS

Purification:

Affinity purification

Molecular weight:

Calculated MW: 31kDa/34kDa/37kDa Observed MW: 80-130KDa

Form:

Liquid

Applications:

IF (Mus musculus, Rattus norvegicus) WB (Mus musculus, Rattus norvegicus) IHC (Mus musculus, Rattus norvegicus, Homo sapiens)

Dilution:

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Storage buffer:

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Storage:

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

More info:

Email: info@sobekbio.com

Orders:

Email: orders@sobekbio.com